Lineage for d1bjxa_ (1bjx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876524Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 2876537Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 2876547Species Human (Homo sapiens) [TaxId:9606] [52851] (3 PDB entries)
  8. 2876549Domain d1bjxa_: 1bjx A: [32774]
    C-terminal domain

Details for d1bjxa_

PDB Entry: 1bjx (more details)

PDB Description: human protein disulfide isomerase, nmr, 24 structures
PDB Compounds: (A:) protein disulfide isomerase

SCOPe Domain Sequences for d1bjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}
aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk
yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta

SCOPe Domain Coordinates for d1bjxa_:

Click to download the PDB-style file with coordinates for d1bjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1bjxa_: