Lineage for d5ingc1 (5ing C:14-263)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113627Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries)
  8. 2113632Domain d5ingc1: 5ing C:14-263 [327732]
    automated match to d3iava1

Details for d5ingc1

PDB Entry: 5ing (more details), 2.45 Å

PDB Description: a crotonyl-coa reductase-carboxylase independent pathway for assembly of unusual alkylmalonyl-coa polyketide synthase extender unit
PDB Compounds: (C:) Putative carboxyl transferase

SCOPe Domain Sequences for d5ingc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ingc1 c.14.1.0 (C:14-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
rtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvg
cpvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltd
ftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvq
tllgylppnn

SCOPe Domain Coordinates for d5ingc1:

Click to download the PDB-style file with coordinates for d5ingc1.
(The format of our PDB-style files is described here.)

Timeline for d5ingc1: