SCOPe 2.04: Domain d1b4qa_: 1b4q A:

Lineage for d1b4qa_ (1b4q A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52848] (2 PDB entries)

8. Domain d1b4qa_: 1b4q A: [32773]
   complexed with gsh

Details for d1b4qa_

PDB Entry: 1b4q

PDB Description: solution structure of human thioltransferase complex with glutathione

PDB Compounds: (A:) protein (human thioltransferase)

SCOPe Domain Sequences for d1b4qa_:

Sequence; same for both SEQRES and ATOM records:

>d1b4qa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Human (Homo sapiens) [TaxId: 9606]}
aqefvnskiqpgkvvvfikptcpysrraqeilsqlpikqgllefvditatnhtneiqdyl
qqltgartvprvfigkdsiggssdlvslqqsgelltrlkqigalq

Timeline for d1b4qa_:

• d1b4qa_ first appeared (with stable ids) in SCOP 1.55
  
• d1b4qa_ appears in SCOPe 2.03
  
• d1b4qa_ appears in SCOPe 2.05
  
• d1b4qa_ appears in the current release, SCOPe 2.08