| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries) |
| Domain d5t52b_: 5t52 B: [327719] automated match to d1hqla_ complexed with a2g, ca, edo, nga |
PDB Entry: 5t52 (more details), 1.7 Å
SCOPe Domain Sequences for d5t52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t52b_ b.29.1.0 (B:) automated matches {Bauhinia forficata [TaxId: 413686]}
selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn
Timeline for d5t52b_: