Lineage for d5t52b_ (5t52 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780732Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries)
  8. 2780740Domain d5t52b_: 5t52 B: [327719]
    automated match to d1hqla_
    complexed with a2g, ca, edo, nga

Details for d5t52b_

PDB Entry: 5t52 (more details), 1.7 Å

PDB Description: lectin from bauhinia forficata in complex with galnac
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d5t52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t52b_ b.29.1.0 (B:) automated matches {Bauhinia forficata [TaxId: 413686]}
selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn

SCOPe Domain Coordinates for d5t52b_:

Click to download the PDB-style file with coordinates for d5t52b_.
(The format of our PDB-style files is described here.)

Timeline for d5t52b_: