Lineage for d1ktea_ (1kte A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852426Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 1852444Species Pig (Sus scrofa) [TaxId:9823] [52847] (1 PDB entry)
  8. 1852445Domain d1ktea_: 1kte A: [32771]

Details for d1ktea_

PDB Entry: 1kte (more details), 2.2 Å

PDB Description: crystal structure of thioltransferase at 2.2 angstrom resolution
PDB Compounds: (A:) thioltransferase

SCOPe Domain Sequences for d1ktea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}
aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk

SCOPe Domain Coordinates for d1ktea_:

Click to download the PDB-style file with coordinates for d1ktea_.
(The format of our PDB-style files is described here.)

Timeline for d1ktea_: