Lineage for d1ktea_ (1kte A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 698992Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 699010Species Pig (Sus scrofa) [TaxId:9823] [52847] (1 PDB entry)
  8. 699011Domain d1ktea_: 1kte A: [32771]

Details for d1ktea_

PDB Entry: 1kte (more details), 2.2 Å

PDB Description: crystal structure of thioltransferase at 2.2 angstrom resolution
PDB Compounds: (A:) thioltransferase

SCOP Domain Sequences for d1ktea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}
aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk

SCOP Domain Coordinates for d1ktea_:

Click to download the PDB-style file with coordinates for d1ktea_.
(The format of our PDB-style files is described here.)

Timeline for d1ktea_: