SCOP 1.73: Domain d1ktea_: 1kte A:

Lineage for d1ktea_ (1kte A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52847] (1 PDB entry)

8. Domain d1ktea_: 1kte A: [32771]

Details for d1ktea_

PDB Entry: 1kte, 2.2 Å

PDB Description: crystal structure of thioltransferase at 2.2 angstrom resolution

PDB Compounds: (A:) thioltransferase

SCOP Domain Sequences for d1ktea_:

Sequence; same for both SEQRES and ATOM records:

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}
aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk

Timeline for d1ktea_:

• d1ktea_ first appeared (with stable ids) in SCOP 1.55, called d1kte__
  
• d1ktea_ was called d1kte__ in SCOP 1.71
  
• d1ktea_ appears in SCOP 1.75
  
• d1ktea_ appears in the current release, SCOPe 2.08