Lineage for d1kte__ (1kte -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (2 proteins) Protein Glutaredoxin (Thioltransferase) [52843] (5 species) 
Species Pig (Sus scrofa) [TaxId:9823] [52847] (1 PDB entry) 
Domain d1kte__: 1kte - [32771]
Details for d1kte__
PDB Entry: 1kte (more details), 2.2 Å
PDB Description: crystal structure of thioltransferase at 2.2 angstrom resolution
SCOP Domain Sequences for d1kte__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kte__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Pig (Sus scrofa)}
aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk
SCOP Domain Coordinates for d1kte__:
Click to download the PDB-style file with coordinates for d1kte__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kte__:
- d1kte__ appears in SCOP 1.57
- d1kte__ appears in the current release, SCOPe 2.08, called d1ktea_
View in 3D