| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
| Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species) |
| Species Escherichia coli, Grx3 [TaxId:562] [52846] (2 PDB entries) |
| Domain d1fova_: 1fov A: [32770] |
PDB Entry: 1fov (more details)
SCOPe Domain Sequences for d1fova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}
anveiytketcpychrakallsskgvsfqelpidgnaakreemikrsgrttvpqifidaq
higgyddlyaldarggldpllk
Timeline for d1fova_: