![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries) |
![]() | Domain d5t55a_: 5t55 A: [327695] automated match to d1hqla_ complexed with ca, cl, edo |
PDB Entry: 5t55 (more details), 1.43 Å
SCOPe Domain Sequences for d5t55a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t55a_ b.29.1.0 (A:) automated matches {Bauhinia forficata [TaxId: 413686]} selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn
Timeline for d5t55a_: