SCOPe 2.06: Domain d5gzna2: 5gzn A:304-407

Lineage for d5gzna2 (5gzn A:304-407)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (5 PDB entries)

8. Domain d5gzna2: 5gzn A:304-407 [327658]
   Other proteins in same PDB: d5gzna1, d5gznb1, d5gznd1, d5gznd2, d5gznl1, d5gznl2
   automated match to d4gsxa2

Details for d5gzna2

PDB Entry: 5gzn, 3 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzna2:

Sequence; same for both SEQRES and ATOM records:

>d5gzna2 b.1.18.0 (A:304-407) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgsti

Timeline for d5gzna2:

• d5gzna2 is new in SCOPe 2.06-stable
  
• d5gzna2 appears in SCOPe 2.07
  
• d5gzna2 appears in the current release, SCOPe 2.08