SCOPe 2.08: Domain d1egra_: 1egr A:

Lineage for d1egra_ (1egr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Escherichia coli [TaxId:562] [52845] (4 PDB entries)

8. Domain d1egra_: 1egr A: [32765]

Details for d1egra_

PDB Entry: 1egr

PDB Description: sequence-specific 1h n.m.r. assignments and determination of the three-dimensional structure of reduced escherichia coli glutaredoxin

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1egra_:

Sequence; same for both SEQRES and ATOM records:

>d1egra_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]}
mqtvifgrsgcpycvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
qifvdqqhiggytdfaawvkenlda

Timeline for d1egra_:

• d1egra_ first appeared (with stable ids) in SCOP 1.55, called d1egr__
  
• d1egra_ appears in SCOPe 2.07