SCOPe 2.06: Domain d5kx5c2: 5kx5 C:246-440

Lineage for d5kx5c2 (5kx5 C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Sheep (Ovis aries) [TaxId:9940] [226224] (15 PDB entries)

8. Domain d5kx5c2: 5kx5 C:246-440 [327648]
   Other proteins in same PDB: d5kx5b1, d5kx5c1, d5kx5d1, d5kx5e_, d5kx5f1, d5kx5f2, d5kx5f3
   automated match to d4i50a2
   complexed with 6yk, adp, ca, gdp, gtp, mg

Details for d5kx5c2

PDB Entry: 5kx5, 2.5 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-compound 11 complex

PDB Compounds: (C:) Tubulin alpha chain

SCOPe Domain Sequences for d5kx5c2:

Sequence; same for both SEQRES and ATOM records:

>d5kx5c2 d.79.2.1 (C:246-440) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5kx5c2:

• d5kx5c2 is new in SCOPe 2.06-stable
  
• d5kx5c2 appears in SCOPe 2.07
  
• d5kx5c2 appears in the current release, SCOPe 2.08