Lineage for d1de2a_ (1de2 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 698992Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 698993Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 698998Domain d1de2a_: 1de2 A: [32764]

Details for d1de2a_

PDB Entry: 1de2 (more details)

PDB Description: nmr structures of reduced bacteriophage t4 glutaredoxin
PDB Compounds: (A:) glutaredoxin

SCOP Domain Sequences for d1de2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de2a_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOP Domain Coordinates for d1de2a_:

Click to download the PDB-style file with coordinates for d1de2a_.
(The format of our PDB-style files is described here.)

Timeline for d1de2a_: