Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) |
Family c.47.1.1: Thioltransferase [52834] (15 proteins) |
Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species) |
Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries) |
Domain d1de2a_: 1de2 A: [32764] |
PDB Entry: 1de2 (more details)
SCOP Domain Sequences for d1de2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de2a_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq igltmpqvfapdgshiggfdqlreyfk
Timeline for d1de2a_: