Lineage for d1de1a_ (1de1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876136Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 2876137Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 2876142Domain d1de1a_: 1de1 A: [32763]

Details for d1de1a_

PDB Entry: 1de1 (more details)

PDB Description: nmr structures of oxidized bacteriophage t4 glutaredoxin
PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1de1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de1a_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOPe Domain Coordinates for d1de1a_:

Click to download the PDB-style file with coordinates for d1de1a_.
(The format of our PDB-style files is described here.)

Timeline for d1de1a_: