Lineage for d5jyma1 (5jym A:1-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763414Superfamily b.1.6: Cadherin-like [49313] (4 families) (S)
  5. 2763525Family b.1.6.0: automated matches [191376] (1 protein)
    not a true family
  6. 2763526Protein automated matches [190458] (4 species)
    not a true protein
  7. 2763541Species Human (Homo sapiens) [TaxId:9606] [255601] (21 PDB entries)
  8. 2763571Domain d5jyma1: 5jym A:1-101 [327624]
    Other proteins in same PDB: d5jymb1, d5jymb2, d5jymb3, d5jymd1, d5jymd2, d5jymd3
    automated match to d4oy9a1
    complexed with ca

Details for d5jyma1

PDB Entry: 5jym (more details), 2.45 Å

PDB Description: human p-cadherin ec12 with scfv tsp11 bound
PDB Compounds: (A:) Cadherin-3

SCOPe Domain Sequences for d5jyma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jyma1 b.1.6.0 (A:1-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dwvvapisvpengkgpfpqrlnqlksnkdrdtkifysitgpgadsppegvfaveketgwl
llnkpldreeiakyelfghavsengasvedpmnisiivtdq

SCOPe Domain Coordinates for d5jyma1:

Click to download the PDB-style file with coordinates for d5jyma1.
(The format of our PDB-style files is described here.)

Timeline for d5jyma1: