SCOP 1.55: Domain d1aazb_: 1aaz B:

Lineage for d1aazb_ (1aaz B:)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.1: Thioltransferase [52834] (2 proteins)

6. Protein Glutaredoxin (Thioltransferase) [52843] (5 species)

7. Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)

8. Domain d1aazb_: 1aaz B: [32762]

Details for d1aazb_

PDB Entry: 1aaz, 2 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)

SCOP Domain Sequences for d1aazb_:

Sequence; same for both SEQRES and ATOM records:

>d1aazb_ c.47.1.1 (B:) Glutaredoxin (Thioltransferase) {Bacteriophage T4}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

Timeline for d1aazb_:

• d1aazb_ appears in SCOP 1.57
  
• d1aazb_ appears in the current release, SCOPe 2.08