Lineage for d1aazb_ (1aaz B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455317Family c.47.1.1: Thioltransferase [52834] (16 protein domains)
  6. 2455325Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 2455326Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 2455329Domain d1aazb_: 1aaz B: [32762]
    complexed with cd

Details for d1aazb_

PDB Entry: 1aaz (more details), 2 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)
PDB Compounds: (B:) glutaredoxin

SCOPe Domain Sequences for d1aazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aazb_ c.47.1.1 (B:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOPe Domain Coordinates for d1aazb_:

Click to download the PDB-style file with coordinates for d1aazb_.
(The format of our PDB-style files is described here.)

Timeline for d1aazb_: