Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species) |
Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (33 PDB entries) |
Domain d5f4xd_: 5f4x D: [327615] automated match to d1ewea_ complexed with gol; mutant |
PDB Entry: 5f4x (more details), 1.84 Å
SCOPe Domain Sequences for d5f4xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f4xd_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllmpnmvtpghact qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn hay
Timeline for d5f4xd_: