Lineage for d5fd5d_ (5fd5 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984523Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries)
  8. 1984527Domain d5fd5d_: 5fd5 D: [327612]
    automated match to d4rb2c_
    complexed with edo, so4

Details for d5fd5d_

PDB Entry: 5fd5 (more details), 1.91 Å

PDB Description: manganese uptake regulator
PDB Compounds: (D:) ferric uptake regulation protein

SCOPe Domain Sequences for d5fd5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fd5d_ a.4.5.0 (D:) automated matches {Rhizobium leguminosarum [TaxId: 387]}
aktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvkl
fedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfr
lvdhrlelygvpl

SCOPe Domain Coordinates for d5fd5d_:

Click to download the PDB-style file with coordinates for d5fd5d_.
(The format of our PDB-style files is described here.)

Timeline for d5fd5d_: