Lineage for d5gpef_ (5gpe F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696470Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2696471Protein automated matches [191102] (6 species)
    not a true protein
  7. 2696483Species Cupriavidus metallidurans [TaxId:266264] [327561] (1 PDB entry)
  8. 2696489Domain d5gpef_: 5gpe F: [327611]
    automated match to d1q06a_
    complexed with pb

Details for d5gpef_

PDB Entry: 5gpe (more details), 2.01 Å

PDB Description: crystal structure of the transcription regulator pbrr691 from ralstonia metallidurans ch34 in complex with lead(ii)
PDB Compounds: (F:) Transcriptional regulator, MerR-family

SCOPe Domain Sequences for d5gpef_:

Sequence, based on SEQRES records: (download)

>d5gpef_ a.6.1.0 (F:) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mmrigelgkkadclvqtvrfyesegllpeparsegnfrlydevhlqrllfirrcrakdmt
ldeirqllnlrdrpelgcgevnalvdahiaqvrtkmkelralerelmdlrrscdsartsr
ecgilnsla

Sequence, based on observed residues (ATOM records): (download)

>d5gpef_ a.6.1.0 (F:) automated matches {Cupriavidus metallidurans [TaxId: 266264]}
mmrigelgkkadclvqtvrfyesegllpeparsnfrlydevhlqrllfirrcrakdmtld
eirqllnlrdrpelgcgevnalvdahiaqvrtkmkelralerelmdlrrscdartsrecg
ilnsla

SCOPe Domain Coordinates for d5gpef_:

Click to download the PDB-style file with coordinates for d5gpef_.
(The format of our PDB-style files is described here.)

Timeline for d5gpef_: