SCOPe 2.05: Domain d1aaza_: 1aaz A:

Lineage for d1aaza_ (1aaz A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)

7. Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)

8. Domain d1aaza_: 1aaz A: [32761]
   complexed with cd

Details for d1aaza_

PDB Entry: 1aaz, 2 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d1aaza_:

Sequence; same for both SEQRES and ATOM records:

>d1aaza_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

Timeline for d1aaza_:

• d1aaza_ first appeared (with stable ids) in SCOP 1.55
  
• d1aaza_ appears in SCOPe 2.04
  
• d1aaza_ appears in SCOPe 2.06
  
• d1aaza_ appears in the current release, SCOPe 2.08