Lineage for d1aaza_ (1aaz A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24118Protein Glutaredoxin (Thioltransferase) [52843] (5 species)
  7. 24119Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 24121Domain d1aaza_: 1aaz A: [32761]

Details for d1aaza_

PDB Entry: 1aaz (more details), 2 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin)

SCOP Domain Sequences for d1aaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aaza_ c.47.1.1 (A:) Glutaredoxin (Thioltransferase) {Bacteriophage T4}
mfkvygydsnihkcvycdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOP Domain Coordinates for d1aaza_:

Click to download the PDB-style file with coordinates for d1aaza_.
(The format of our PDB-style files is described here.)

Timeline for d1aaza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aazb_