Lineage for d5fb9b_ (5fb9 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343242Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2343243Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2343278Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2343279Protein automated matches [194369] (3 species)
    not a true protein
  7. 2343280Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries)
  8. 2343283Domain d5fb9b_: 5fb9 B: [327607]
    automated match to d1ak0a_
    complexed with btb, na, nag, zn

Details for d5fb9b_

PDB Entry: 5fb9 (more details), 1.5 Å

PDB Description: s1 nuclease from aspergillus oryzae with unoccupied active site
PDB Compounds: (B:) Nuclease S1

SCOPe Domain Sequences for d5fb9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fb9b_ a.124.1.0 (B:) automated matches {Aspergillus oryzae [TaxId: 510516]}
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasq

SCOPe Domain Coordinates for d5fb9b_:

Click to download the PDB-style file with coordinates for d5fb9b_.
(The format of our PDB-style files is described here.)

Timeline for d5fb9b_: