Lineage for d5fd6c_ (5fd6 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308393Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries)
  8. 2308401Domain d5fd6c_: 5fd6 C: [327606]
    automated match to d4rb2c_
    complexed with gol, so4, zn

Details for d5fd6c_

PDB Entry: 5fd6 (more details), 2.48 Å

PDB Description: zinc-bound manganese uptake regulator
PDB Compounds: (C:) ferric uptake regulation protein

SCOPe Domain Sequences for d5fd6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fd6c_ a.4.5.0 (C:) automated matches {Rhizobium leguminosarum [TaxId: 387]}
ktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklf
edagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrl
vdhrlelygvpl

SCOPe Domain Coordinates for d5fd6c_:

Click to download the PDB-style file with coordinates for d5fd6c_.
(The format of our PDB-style files is described here.)

Timeline for d5fd6c_: