Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries) |
Domain d5fd6c_: 5fd6 C: [327606] automated match to d4rb2c_ complexed with gol, so4, zn |
PDB Entry: 5fd6 (more details), 2.48 Å
SCOPe Domain Sequences for d5fd6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fd6c_ a.4.5.0 (C:) automated matches {Rhizobium leguminosarum [TaxId: 387]} ktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrtvklf edagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriarehgfrl vdhrlelygvpl
Timeline for d5fd6c_: