SCOPe 2.08: Domain d5fbgb_: 5fbg B:

Lineage for d5fbgb_ (5fbg B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
   multihelical

4. Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families)
   duplication: all chain but the N-terminal helix forms two structural repeats

5. Family a.124.1.0: automated matches [194368] (1 protein)
   not a true family

6. Protein automated matches [194369] (3 species)
   not a true protein

7. Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries)

8. Domain d5fbgb_: 5fbg B: [327605]
   automated match to d1ak0a_
   complexed with dcz, gng, nag, po4, zn; mutant

Details for d5fbgb_

PDB Entry: 5fbg, 1.97 Å

PDB Description: s1 nuclease from aspergillus oryzae, mutant d65n, in complex with phosphate, 2'-deoxycytidine and 2'-deoxyguanosine.

PDB Compounds: (B:) Nuclease S1

SCOPe Domain Sequences for d5fbgb_:

Sequence; same for both SEQRES and ATOM records:

>d5fbgb_ a.124.1.0 (B:) automated matches {Aspergillus oryzae [TaxId: 510516]}
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwantykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasq

Timeline for d5fbgb_:

• d5fbgb_ first appeared in SCOPe 2.06
  
• d5fbgb_ appears in SCOPe 2.07