Lineage for d1abaa_ (1aba A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 698984Family c.47.1.1: Thioltransferase [52834] (15 proteins)
  6. 698992Protein Glutaredoxin (Grx, thioltransferase) [52843] (5 species)
  7. 698993Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 698994Domain d1abaa_: 1aba A: [32760]
    complexed with mes; mutant

Details for d1abaa_

PDB Entry: 1aba (more details), 1.45 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins
PDB Compounds: (A:) glutaredoxin

SCOP Domain Sequences for d1abaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]}
mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOP Domain Coordinates for d1abaa_:

Click to download the PDB-style file with coordinates for d1abaa_.
(The format of our PDB-style files is described here.)

Timeline for d1abaa_: