Lineage for d5fbca_ (5fbc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336585Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
    multihelical
  4. 2336586Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) (S)
    duplication: all chain but the N-terminal helix forms two structural repeats
  5. 2336621Family a.124.1.0: automated matches [194368] (1 protein)
    not a true family
  6. 2336622Protein automated matches [194369] (3 species)
    not a true protein
  7. 2336623Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries)
  8. 2336627Domain d5fbca_: 5fbc A: [327598]
    automated match to d1ak0a_
    complexed with as, gol, nag, zn

Details for d5fbca_

PDB Entry: 5fbc (more details), 1.75 Å

PDB Description: s1 nuclease from aspergillus oryzae in complex with 2'-deoxyadenosine- 5'-thio-monophosphate (5'damp(s)).
PDB Compounds: (A:) Nuclease S1

SCOPe Domain Sequences for d5fbca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbca_ a.124.1.0 (A:) automated matches {Aspergillus oryzae [TaxId: 510516]}
wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
qpvfeeliakagyrlaawldliasqps

SCOPe Domain Coordinates for d5fbca_:

Click to download the PDB-style file with coordinates for d5fbca_.
(The format of our PDB-style files is described here.)

Timeline for d5fbca_: