![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily) multihelical |
![]() | Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families) ![]() duplication: all chain but the N-terminal helix forms two structural repeats |
![]() | Family a.124.1.0: automated matches [194368] (1 protein) not a true family |
![]() | Protein automated matches [194369] (3 species) not a true protein |
![]() | Species Aspergillus oryzae [TaxId:510516] [327581] (7 PDB entries) |
![]() | Domain d5fbda_: 5fbd A: [327590] automated match to d1ak0a_ complexed with dcz, nag, po4, zn |
PDB Entry: 5fbd (more details), 1.75 Å
SCOPe Domain Sequences for d5fbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fbda_ a.124.1.0 (A:) automated matches {Aspergillus oryzae [TaxId: 510516]} wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks qpvfeeliakagyrlaawldliasqps
Timeline for d5fbda_: