Lineage for d1trv__ (1trv -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries) 
Domain d1trv__: 1trv - [32759]
Details for d1trv__
PDB Entry: 1trv (more details)
PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
SCOP Domain Sequences for d1trv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trv__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
SCOP Domain Coordinates for d1trv__:
Click to download the PDB-style file with coordinates for d1trv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trv__:
- d1trv__ first appeared (with stable ids) in SCOP 1.55
- d1trv__ appears in SCOP 1.57
- d1trv__ appears in SCOP 1.61
- d1trv__ appears in the current release, SCOPe 2.08, called d1trva_
View in 3D