Lineage for d1trva_ (1trv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876344Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)
  8. 2876376Domain d1trva_: 1trv A: [32759]

Details for d1trva_

PDB Entry: 1trv (more details)

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1trva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trva_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOPe Domain Coordinates for d1trva_:

Click to download the PDB-style file with coordinates for d1trva_.
(The format of our PDB-style files is described here.)

Timeline for d1trva_: