SCOPe 2.08: Domain d5h9gb1: 5h9g B:1-75

Lineage for d5h9gb1 (5h9g B:1-75)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:570508] [327571] (2 PDB entries)

8. Domain d5h9gb1: 5h9g B:1-75 [327588]
   Other proteins in same PDB: d5h9ga2, d5h9gb2
   automated match to d3gzmb_

Details for d5h9gb1

PDB Entry: 5h9g, 2.6 Å

PDB Description: apo-acp from helicobacter pylori

PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d5h9gb1:

Sequence; same for both SEQRES and ATOM records:

>d5h9gb1 a.28.1.0 (B:1-75) automated matches {Helicobacter pylori [TaxId: 570508]}
malfediqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqae
kivnvgdvvkyiedn

Timeline for d5h9gb1:

• d5h9gb1 first appeared in SCOPe 2.06
  
• d5h9gb1 appears in SCOPe 2.07