| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Helicobacter pylori [TaxId:570508] [327571] (2 PDB entries) |
| Domain d5h9gb1: 5h9g B:1-75 [327588] Other proteins in same PDB: d5h9ga2, d5h9gb2 automated match to d3gzmb_ |
PDB Entry: 5h9g (more details), 2.6 Å
SCOPe Domain Sequences for d5h9gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h9gb1 a.28.1.0 (B:1-75) automated matches {Helicobacter pylori [TaxId: 570508]}
malfediqaviaeqlnvdaaqvtpeaefvkdlgadsldvvelimaleekfgieipdeqae
kivnvgdvvkyiedn
Timeline for d5h9gb1: