| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Rhizobium leguminosarum [TaxId:387] [327554] (2 PDB entries) |
| Domain d5fd5a_: 5fd5 A: [327586] automated match to d4rb2c_ complexed with edo, so4 |
PDB Entry: 5fd5 (more details), 1.91 Å
SCOPe Domain Sequences for d5fd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fd5a_ a.4.5.0 (A:) automated matches {Rhizobium leguminosarum [TaxId: 387]}
tdvaktleelatergmrmteqrrviariledsedhpdveelyrrsvkvdakisistvyrt
vklfedagiiarhdfrdgrsryetvpeehhdhlidlktgtviefrspeiealqeriareh
gfrlvdhrlelygvplk
Timeline for d5fd5a_:
View in 3DDomains from other chains: (mouse over for more information) d5fd5b_, d5fd5c_, d5fd5d_, d5fd5e_ |