Lineage for d5fg8a_ (5fg8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984898Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [238471] (4 PDB entries)
  8. 2984900Domain d5fg8a_: 5fg8 A: [327580]
    automated match to d3kk8a_
    complexed with adp, gol, mg

Details for d5fg8a_

PDB Entry: 5fg8 (more details), 1.96 Å

PDB Description: drosophila camkii-wt in complex with a fragment of the eag potassium channel and mg2+/adp
PDB Compounds: (A:) calcium/calmodulin-dependent protein kinase type II alpha chain

SCOPe Domain Sequences for d5fg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fg8a_ d.144.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctrfsdnydikeelgkgafsivkrcvqkstgfefaakiintkkltardfqklerearicr
klhhpnivrlhdsiqeenyhylvfdlvtggelfedivarefyseadashciqqilesvnh
chqngvvhrdlkpenlllaskakgaavkladfglaievqgdhqawfgfagtpgylspevl
kkepygksvdiwacgvilyillvgyppfwdedqhrlysqikagaydypspewdtvtpeak
nlinqmltvnpnkritaaealkhpwicqr

SCOPe Domain Coordinates for d5fg8a_:

Click to download the PDB-style file with coordinates for d5fg8a_.
(The format of our PDB-style files is described here.)

Timeline for d5fg8a_: