SCOPe 2.06: Domain d1trua_: 1tru A:

Lineage for d1trua_ (1tru A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d1trua_: 1tru A: [32758]

Details for d1trua_

PDB Entry: 1tru

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1trua_:

Sequence; same for both SEQRES and ATOM records:

>d1trua_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

Timeline for d1trua_:

• d1trua_ first appeared (with stable ids) in SCOP 1.55, called d1tru__
  
• d1trua_ appears in SCOPe 2.05
  
• d1trua_ appears in SCOPe 2.07
  
• d1trua_ appears in the current release, SCOPe 2.08