![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
![]() | Protein automated matches [191102] (6 species) not a true protein |
![]() | Species Cupriavidus metallidurans [TaxId:266264] [327561] (1 PDB entry) |
![]() | Domain d5gpeh_: 5gpe H: [327570] automated match to d1q06a_ complexed with pb |
PDB Entry: 5gpe (more details), 2.01 Å
SCOPe Domain Sequences for d5gpeh_:
Sequence, based on SEQRES records: (download)
>d5gpeh_ a.6.1.0 (H:) automated matches {Cupriavidus metallidurans [TaxId: 266264]} mmrigelgkkadclvqtvrfyesegllpeparsegnfrlydevhlqrllfirrcrakdmt ldeirqllnlrdrpelgcgevnalvdahiaqvrtkmkelralerelmdlrrscdsartsr ecgilnsla
>d5gpeh_ a.6.1.0 (H:) automated matches {Cupriavidus metallidurans [TaxId: 266264]} mmrigelgkkadclvqtvrfyesegllpeparsegnfrlydevhlqrllfirrcrakdmt ldeirqllnlrdrpelgcgevnalvdahiaqvrtkmkelralerelmdlrrscdartsre cgilnsla
Timeline for d5gpeh_: