Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Serratia marcescens [TaxId:615] [327556] (4 PDB entries) |
Domain d5fdha1: 5fdh A:22-265 [327568] Other proteins in same PDB: d5fdha2, d5fdhb2 automated match to d4s2na_ complexed with gol, so4 |
PDB Entry: 5fdh (more details), 2.26 Å
SCOPe Domain Sequences for d5fdha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fdha1 e.3.1.0 (A:22-265) automated matches {Serratia marcescens [TaxId: 615]} mkewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslial dlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlha fdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteang dyiiraktgyspkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip
Timeline for d5fdha1: