Lineage for d5fdha1 (5fdh A:22-265)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3015033Species Serratia marcescens [TaxId:615] [327556] (4 PDB entries)
  8. 3015036Domain d5fdha1: 5fdh A:22-265 [327568]
    Other proteins in same PDB: d5fdha2, d5fdhb2
    automated match to d4s2na_
    complexed with gol, so4

Details for d5fdha1

PDB Entry: 5fdh (more details), 2.26 Å

PDB Description: crystal structure of oxa-405 beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5fdha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdha1 e.3.1.0 (A:22-265) automated matches {Serratia marcescens [TaxId: 615]}
mkewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnslial
dlgvvkdehqvfkwdgqtrdiatwnrdhnlitamkysvvpvyqefarqigearmskmlha
fdygnedisgnvdsfwldggirisateqisflrklyhnklhvsersqrivkqamlteang
dyiiraktgyspkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqekiip

SCOPe Domain Coordinates for d5fdha1:

Click to download the PDB-style file with coordinates for d5fdha1.
(The format of our PDB-style files is described here.)

Timeline for d5fdha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fdha2