Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein automated matches [190043] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
Domain d5fw9a_: 5fw9 A: [327563] automated match to d2f2va_ |
PDB Entry: 5fw9 (more details), 1.55 Å
SCOPe Domain Sequences for d5fw9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fw9a_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kylvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkyld
Timeline for d5fw9a_: