SCOPe 2.05: Domain d1cqga_: 1cqg A:

Lineage for d1cqga_ (1cqg A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d1cqga_: 1cqg A: [32756]
   mutant

Details for d1cqga_

PDB Entry: 1cqg

PDB Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, 31 structures

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1cqga_:

Sequence; same for both SEQRES and ATOM records:

>d1cqga_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

Timeline for d1cqga_:

• d1cqga_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqga_ appears in SCOPe 2.04
  
• d1cqga_ appears in SCOPe 2.06
  
• d1cqga_ appears in the current release, SCOPe 2.08