Lineage for d4trx__ (4trx -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70803Family c.47.1.1: Thioltransferase [52834] (5 proteins)
  6. 70830Protein Thioredoxin [52835] (7 species)
  7. 70852Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries)
  8. 70864Domain d4trx__: 4trx - [32754]

Details for d4trx__

PDB Entry: 4trx (more details)

PDB Description: high-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution

SCOP Domain Sequences for d4trx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4trx__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkctptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d4trx__:

Click to download the PDB-style file with coordinates for d4trx__.
(The format of our PDB-style files is described here.)

Timeline for d4trx__: