SCOPe 2.08: Domain d4trxa_: 4trx A:

Lineage for d4trxa_ (4trx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d4trxa_: 4trx A: [32754]

Details for d4trxa_

PDB Entry: 4trx

PDB Description: high-resolution three-dimensional structure of reduced recombinant human thioredoxin in solution

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d4trxa_:

Sequence; same for both SEQRES and ATOM records:

>d4trxa_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevkctptfqffkkgqkvgefsgankekleatinelv

Timeline for d4trxa_:

• d4trxa_ first appeared (with stable ids) in SCOP 1.55, called d4trx__
  
• d4trxa_ appears in SCOPe 2.07