SCOPe 2.08: Domain d5ltpf1: 5ltp F:0-219

Lineage for d5ltpf1 (5ltp F:0-219)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)

8. Domain d5ltpf1: 5ltp F:0-219 [327538]
   Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2
   automated match to d3neda_
   complexed with cl, flc

Details for d5ltpf1

PDB Entry: 5ltp, 1.7 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the acidic ph 4.5

PDB Compounds: (F:) mNeonGreen

SCOPe Domain Sequences for d5ltpf1:

Sequence; same for both SEQRES and ATOM records:

>d5ltpf1 d.22.1.0 (F:0-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
maslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigy
gfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkg
tgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfak
pmaanylknqpmyvfrktelkhsktelnfkewqkaftdvm

Timeline for d5ltpf1:

• d5ltpf1 first appeared in SCOPe 2.06
  
• d5ltpf1 appears in SCOPe 2.07