![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin-like domain of parkin [89831] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89832] (2 PDB entries) |
![]() | Domain d5tr5a_: 5tr5 A: [327537] automated match to d1iyfa_ |
PDB Entry: 5tr5 (more details)
SCOPe Domain Sequences for d5tr5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tr5a_ d.15.1.1 (A:) Ubiquitin-like domain of parkin {Human (Homo sapiens) [TaxId: 9606]} mivfvrfnsshgfpvevdsdtsifqlkevvakrqgvpadqlrvifagkelrndwtvqncd ldqqsivhivqrpwrk
Timeline for d5tr5a_: