Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [327523] (1 PDB entry) |
Domain d5u4na_: 5u4n A: [327524] automated match to d3gaya_ complexed with edo, po4 |
PDB Entry: 5u4n (more details), 1.6 Å
SCOPe Domain Sequences for d5u4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u4na_ c.1.10.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} malvsmrqlldhaaensyglpafnvnnleqmraimeaadqvnapvivqasagarkyagap flrhlilaaveefphipvvmhqdhgaspdvcqrsiqlgfssvmmdgslledgktpssyey nvnatrtvvnfshacgvsvegeigvlgnletgeageedgvgaagklshdqmltsvedavr fvkdtgvdalaiavgtshgaykftrpptgdvlridrikeihqalpnthivmhgsssvpqe wlkvineyggnigetygvpveeivegikhgvrkvnidtdlrlastgavrrylaenpsdfd prkylgktieamkqicldrylafgcegqagkikpvslekmasryakgeln
Timeline for d5u4na_: