Lineage for d1mdka_ (1mdk A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395913Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)
  8. 395927Domain d1mdka_: 1mdk A: [32752]
    mutant

Details for d1mdka_

PDB Entry: 1mdk (more details)

PDB Description: high resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human nfkb (residues 56-68 of the p50 subunit of nfkb)

SCOP Domain Sequences for d1mdka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdka_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpakmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1mdka_:

Click to download the PDB-style file with coordinates for d1mdka_.
(The format of our PDB-style files is described here.)

Timeline for d1mdka_: