Lineage for d5thsa_ (5ths A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874190Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2874235Protein automated matches [190786] (1 species)
    not a true protein
  7. 2874236Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries)
  8. 2874259Domain d5thsa_: 5ths A: [327517]
    automated match to d2v5wb_
    complexed with b3n, edo, k, zn

Details for d5thsa_

PDB Entry: 5ths (more details), 1.9 Å

PDB Description: crystal structure of g302a hdac8 in complex with m344
PDB Compounds: (A:) Histone deacetylase 8

SCOPe Domain Sequences for d5thsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5thsa_ c.42.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilagggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d5thsa_:

Click to download the PDB-style file with coordinates for d5thsa_.
(The format of our PDB-style files is described here.)

Timeline for d5thsa_: