![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [327514] (2 PDB entries) |
![]() | Domain d5u26a1: 5u26 A:1-159 [327515] Other proteins in same PDB: d5u26a2 automated match to d1df7a_ complexed with edo, mmv, nap, so4 |
PDB Entry: 5u26 (more details), 1.85 Å
SCOPe Domain Sequences for d5u26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u26a1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp reagdalapvldetwrgetgewrfsrsglryrlysyhrs
Timeline for d5u26a1: