Lineage for d5u26a1 (5u26 A:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903965Species Mycobacterium tuberculosis [TaxId:1773] [327514] (2 PDB entries)
  8. 2903966Domain d5u26a1: 5u26 A:1-159 [327515]
    Other proteins in same PDB: d5u26a2
    automated match to d1df7a_
    complexed with edo, mmv, nap, so4

Details for d5u26a1

PDB Entry: 5u26 (more details), 1.85 Å

PDB Description: crystal structure of mycobacterium tuberculosis dihydrofolate reductase bound to nadp and p218 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5u26a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u26a1 c.71.1.1 (A:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

SCOPe Domain Coordinates for d5u26a1:

Click to download the PDB-style file with coordinates for d5u26a1.
(The format of our PDB-style files is described here.)

Timeline for d5u26a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5u26a2