Lineage for d5m98b2 (5m98 B:143-294)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207860Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2207861Protein automated matches [227009] (13 species)
    not a true protein
  7. 2207901Species Danio rerio [TaxId:7955] [327451] (2 PDB entries)
  8. 2207921Domain d5m98b2: 5m98 B:143-294 [327511]
    automated match to d4n9sa2

Details for d5m98b2

PDB Entry: 5m98 (more details), 2.8 Å

PDB Description: crystal structure of urate oxidase from zebrafish
PDB Compounds: (B:) Uricase

SCOPe Domain Sequences for d5m98b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m98b2 d.96.1.0 (B:143-294) automated matches {Danio rerio [TaxId: 7955]}
sktpvvhsglkdmkvlkttqtgfegflrdrfttltdakdrffctsvyarwryntinvafd
aawkavkdtviqkfagpydrgeyspsvqktlydtqllvldripeveeieiimpnqhyfvi
dmtkiglsnkdevylpldnpsgnitgtvcrkp

SCOPe Domain Coordinates for d5m98b2:

Click to download the PDB-style file with coordinates for d5m98b2.
(The format of our PDB-style files is described here.)

Timeline for d5m98b2: