Lineage for d5mn4a1 (5mn4 A:12-208)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121563Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2121564Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2121565Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2121566Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2121615Species Staphylococcus aureus [TaxId:1280] [226386] (6 PDB entries)
  8. 2121616Domain d5mn4a1: 5mn4 A:12-208 [327505]
    Other proteins in same PDB: d5mn4a2
    automated match to d4dxda1
    complexed with gdp, mpd

Details for d5mn4a1

PDB Entry: 5mn4 (more details), 1.5 Å

PDB Description: s. aureus ftsz 12-316 f138a gdp open form (1fof)
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d5mn4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mn4a1 c.32.1.1 (A:12-208) Cell-division protein FtsZ {Staphylococcus aureus [TaxId: 1280]}
atlkvigvggggnnavnrmidhgmnnvefiaintdgqalnlskaeskiqigekltrglga
ganpeigkkaaeesreqiedaiqgadmvfvtsgmgggtgtgaapvvakiakemgaltvgv
vtrpfsaegrkrqtqaaagveamkaavdtlivipndrlldivdkstpmmeafkeadnvlr
qgvqgisdliavsgevn

SCOPe Domain Coordinates for d5mn4a1:

Click to download the PDB-style file with coordinates for d5mn4a1.
(The format of our PDB-style files is described here.)

Timeline for d5mn4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mn4a2