Lineage for d1trw__ (1trw -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (12 families) 
Family c.47.1.1: Thioltransferase [52834] (6 proteins) 
Protein Thioredoxin [52835] (7 species) 
Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries) 
Domain d1trw__: 1trw - [32750]
Details for d1trw__
PDB Entry: 1trw (more details)
PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
SCOP Domain Sequences for d1trw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1trw__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv
SCOP Domain Coordinates for d1trw__:
Click to download the PDB-style file with coordinates for d1trw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1trw__:
- d1trw__ first appeared (with stable ids) in SCOP 1.55
- d1trw__ appears in SCOP 1.59
- d1trw__ appears in SCOP 1.63
- d1trw__ appears in the current release, SCOPe 2.08, called d1trwa_
View in 3D