Lineage for d1trw__ (1trw -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123183Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 123213Protein Thioredoxin [52835] (7 species)
  7. 123239Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries)
  8. 123250Domain d1trw__: 1trw - [32750]

Details for d1trw__

PDB Entry: 1trw (more details)

PDB Description: the high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin

SCOP Domain Sequences for d1trw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trw__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
daqdvaseaevkatptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1trw__:

Click to download the PDB-style file with coordinates for d1trw__.
(The format of our PDB-style files is described here.)

Timeline for d1trw__: